Sale!

Cagrilintide 5mg

Original price was: €56.17.Current price is: €41.48.

Product Description

Chemical Information:

  • Molecular Formula: C₁₇₄H₂₇₆N₅₂O₅₅
  • Molecular Weight: 3946.32 g/mol
  • Sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH₂ (Modified for prolonged half-life and enhanced receptor affinity)
  • Molecular Structure: Refer to Certificate of Analysis for detailed structural information.

Description:
Cagrilintide is a synthetic long-acting analog of human amylin, a peptide extensively studied for its potential roles in appetite regulation, energy balance, and metabolic control. Engineered for prolonged receptor activation, Cagrilintide supports research into mechanisms governing satiety, food intake, weight management, and metabolic signaling pathways. Provided as a lyophilized powder, it is ideal for advanced research into metabolic function, energy homeostasis, and obesity-related pathways.


Research Applications:
Cagrilintide is actively studied for potential roles in:

  • Appetite and Weight Regulation: Investigating effects on food intake suppression and satiety signaling pathways.
  • Metabolic Control: Evaluating impacts on glucose metabolism, insulin sensitivity, and lipid profile improvements.
  • Obesity Research: Examining mechanisms underlying sustained weight loss and energy balance modulation.
  • Gastrointestinal and Neuroendocrine Studies: Exploring interactions with gastrointestinal motility, nutrient absorption, and central signaling pathways involved in hunger and satiety.

Storage and Handling:

  • Store lyophilized powder at -20°C.
  • After reconstitution, refrigerate at 2-8°C and use promptly.
  • Maintain aseptic handling practices to ensure sterility and product integrity.

Product Specifications:

  • Purity: ≥99% (HPLC Verified)
  • Appearance: Lyophilized white powder
  • Solubility: Soluble in bacteriostatic water

Important Note:
This product is strictly FOR RESEARCH USE ONLY and is intended exclusively for in vitro research and laboratory experimentation by qualified professionals. It is not a drug, food, cosmetic, or dietary supplement, and has not been evaluated by the FDA. This peptide is not intended to diagnose, treat, cure, or prevent any disease. The bodily introduction into humans or animals is strictly prohibited by law. Any misuse, misbranding, or mislabeling is a violation of federal regulations and may result in legal action under applicable federal, state, or local laws.


References:
Referenced scientific publications include:

  • Lau, D. C., et al. (2021). “Cagrilintide, a Long-Acting Amylin Analogue, for Weight Management in Adults with Overweight and Obesity: A Randomised, Controlled, Phase 2 Trial.” The Lancet.
  • Enebo, L. B., et al. (2021). “Safety, Tolerability, and Efficacy of Cagrilintide for Weight Management: Findings from a Phase 1 Clinical Study.” Diabetes, Obesity and Metabolism.

Description

Buy Oasis Peptides Retatrutide: Unlock Maximum Wellness and Weight Management

Looking for a reliable peptide to support weight management and metabolic health? Oasis peptides retatrutide is a cutting-edge peptide therapy designed to help you achieve your health goals efficiently and safely. Trusted by professionals and wellness enthusiasts alike, Oasis Peptides ensures premium quality and purity, giving you confidence in every dose.

What Is Oasis Peptides Retatrutide?

Oasis peptides retatrutide is a synthetic peptide that mimics naturally occurring hormones in your body that regulate appetite, fat metabolism, and glucose levels. By activating specific receptors, this peptide can help reduce cravings, enhance fat loss, and improve metabolic balance. Unlike generic alternatives, Oasis Peptides guarantees high-quality formulations, rigorously tested for potency and safety.

This peptide has become increasingly popular among individuals aiming to optimize weight management, enhance energy, and support overall wellness. Its carefully crafted formula makes it suitable for both men and women looking for reliable, science-backed results.

Benefits of Oasis Peptides Retatrutide

Choosing Oasis peptides retatrutide comes with multiple benefits, including:

  • Effective Weight Management: Supports fat burning and helps control appetite naturally.

  • Metabolic Support: Helps regulate blood sugar levels and improve metabolic efficiency.

  • Energy and Vitality: Many users report increased energy and mental clarity.

  • Safe and Reliable: Produced in a certified facility, ensuring purity and consistency.

These benefits make Oasis Peptides Retatrutide an ideal solution for anyone serious about achieving sustainable wellness results.

How to Use Oasis Peptides Retatrutide

Proper use is key to maximizing the effectiveness of Oasis peptides retatrutide. The peptide is typically administered via subcutaneous injection. Experts recommend starting with a lower dose to assess tolerance and gradually increasing according to your goals and healthcare provider’s guidance.

Step-by-Step Guide:

  1. Wash your hands thoroughly and prepare a clean injection site.

  2. Use a sterile needle and draw the recommended dose.

  3. Inject subcutaneously into the abdomen, thigh, or upper arm.

  4. Rotate injection sites to prevent irritation.

  5. Monitor your response and adjust dosage under professional supervision.

Following these steps ensures safe, effective use and maximizes the benefits of your Oasis Peptides Retatrutide therapy.

Why Buy from Oasis Peptides

Purchasing Oasis peptides retatrutide from Oasis Peptides comes with several advantages:

  • Premium Quality: Each batch undergoes strict testing for purity and potency.

  • Fast Shipping: Get your product delivered quickly and discreetly.

  • Expert Support: Access guidance on dosage, administration, and wellness tips.

  • Satisfaction Guarantee: Trusted by thousands of satisfied customers worldwide.

Investing in a high-quality peptide from a reputable provider ensures you get real results safely.

Get Started Today

If you’re ready to transform your wellness routine, now is the perfect time to try Oasis peptides retatrutide. With proven effectiveness, premium quality, and comprehensive support, it’s a top choice for anyone looking to achieve weight management and metabolic health goals.

Order your Oasis Peptides Retatrutide today and take the first step toward a healthier, more energized you!

Reviews

There are no reviews yet.

Be the first to review “Cagrilintide 5mg”

Your email address will not be published. Required fields are marked *